| Patents for A01N 1 - Preservation of bodies of humans or animals, or parts thereof (10,493) |
|---|
| 05/24/2007 | US20070116677 administering secretoneurin intracerebrally into an affected area and the brain tissue damage is caused by cerebral ischemia or stroke; a 33-amino acid neuropeptide (TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ: SEQ ID NO: 1) |
| 05/24/2007 | CA2629283A1 Methods for preparing cord matrix stem cells (cmsc) for long term storage and for preparing a segment of umbilical cord for cryopreservation |
| 05/23/2007 | EP1788072A1 Biosample freezing apparatus and method of freezing |
| 05/23/2007 | EP1787512A1 Method for the cryopreservation of human blood |
| 05/23/2007 | CN1968601A Liver disease-related methods and systems |
| 05/22/2007 | US7220584 Method of making embryoid bodies from primate embryonic stem cells |
| 05/22/2007 | US7220538 Bilayered support comprising nanoparticles for use in preserving organs and tissues; tissue repair and replacement; tissue engineering |
| 05/18/2007 | WO2007056572A1 Selection, propagation and use of mosaic aneuploid stem cells |
| 05/18/2007 | WO2007055714A2 Compositions and methods for the evaluation and resuscitation of cadaveric hearts for transplant |
| 05/18/2007 | WO2007055705A1 Micro organ bath system and methods |
| 05/18/2007 | WO2007054160A2 Method for the cryopreservation of human blood |
| 05/18/2007 | WO2006029233A9 Apparatus for prolonging survival of platelets |
| 05/18/2007 | CA2665002A1 Selection, propagation and use of mosaic aneuploid stem cells |
| 05/18/2007 | CA2638162A1 Compositions and methods for the evaluation and resuscitation of cadaveric hearts for transplant |
| 05/18/2007 | CA2628341A1 The use of apoptotic cells ex vivo to generate regulatory t cells |
| 05/17/2007 | US20070111191 Storage of blood |
| 05/17/2007 | US20070110740 Composition and methods for tissue preservation |
| 05/17/2007 | US20070110666 Methods for preparation of live body tissues for examination |
| 05/16/2007 | EP1699799B1 Control of parasites in animals by the use of imidazo [1,2-b]pyridazine derivatives |
| 05/16/2007 | CN1315770C Method and device for producing formic acid formates and use of said formates |
| 05/16/2007 | CN1315375C Proved method for cryopreservation and recovery of red blood cells |
| 05/16/2007 | CN1315374C Systems and methods for freezing and storing biopharmaceutical material |
| 05/15/2007 | US7217935 System for chemical and biological decontamination |
| 05/15/2007 | US7217759 Composition and use |
| 05/15/2007 | US7217439 Arranging of a mesh sheet on the surface of the canvas for the dyed drawing, arranging leaves and flowers on the upper surface of a mesh sheet, covering the plant matter with a synthetic resin sheet, creating the dyed drawing on the canvas including pushing the leaves and flowers to the mesh sheet |
| 05/15/2007 | CA2293555C Use of 2-mercapto-pyridine-n-oxide |
| 05/15/2007 | CA2210532C Method and package design for cryopreservation and storage of cultured tissue equivalents |
| 05/10/2007 | WO2007053779A2 Delivery of agents to tissue |
| 05/10/2007 | WO2006102304A3 Use of fluorinated fluids as storage liquid for preserved biological specimens |
| 05/10/2007 | US20070106208 Delivery of agents to tissue |
| 05/10/2007 | US20070105220 Reconstituting lyophillized erythrocytes with a solution of trehalose or another oligosaccharide solute having a concentration large enough to produce hyperosmotic pressure on the cell to transfer the solute from the solution into the cell |
| 05/10/2007 | US20070105188 determining sperm quality, and different storage media's effect thereon; male fertility |
| 05/10/2007 | DE10340488B4 Extrakorporale Organaufbewahrung Extracorporeal organ preservation |
| 05/09/2007 | EP1781097A2 Liver disease-related methods and systems |
| 05/09/2007 | EP1168912B1 Organ arrest, protection and preservation |
| 05/09/2007 | EP1117766B1 Method and apparatus for the storage of entomopathogenic nematodes |
| 05/09/2007 | CN2896900Y Refrigeration bag for transplanting kidney |
| 05/09/2007 | CN1960768A Methods for uniformly treating biological samples with electromagnetic radiation |
| 05/03/2007 | WO2006090372A3 Preserved viable cartilage, method for its preservation, and system and devices used therefor |
| 05/03/2007 | WO2005079514A3 Preservation of blood vessels for grafting using inhibitors of tnf-alpha |
| 05/03/2007 | WO2005079145A3 Tissue system with undifferentiated stem cells derived from corneal limbus |
| 05/03/2007 | US20070099172 Methods and device for freezing and thawing biological samples |
| 05/03/2007 | US20070099171 Sperm Suspensions for Sorting Into X or Y Chromosome-bearing Enriched Populations |
| 05/03/2007 | US20070099170 Method for treatment and storage of blood and blood products using endogenous alloxazines and acetate |
| 05/03/2007 | US20070098924 Realistic model plant structure |
| 05/03/2007 | US20070098699 Process for preparing bone marrow stem cells, and composition related thereto |
| 05/03/2007 | US20070098694 Compositions and methods for the evaluation and resuscitation of cadaveric hearts for transplant |
| 05/02/2007 | EP1778880A2 Methods and reagents for diagnosing hantavirus infection |
| 05/02/2007 | EP1778007A1 Method and apparatus for freezing or thawing of a biological material |
| 05/02/2007 | EP0912085B1 Precise efficacy assay methods for active agents including chemotherapeutic agents |
| 05/02/2007 | CN1956655A Apparatus for closing body cavity of dead body and apparatus of treating dead body |
| 05/02/2007 | CA2566024A1 Prefix tissue cassette |
| 05/01/2007 | CA2337632C Container arrangement and method for transporting equine semen |
| 05/01/2007 | CA2301023C Cassette device and system to facilitate cryopreservation |
| 04/26/2007 | WO2005054808A3 Method for sex biasing spermatozoa |
| 04/26/2007 | US20070093739 Selective adsorption devices and systems |
| 04/26/2007 | US20070092860 cryopreserving sperm that have been selected for a specific characteristic; for artificial insemination or in vitro fertilization |
| 04/25/2007 | EP1776952A2 Photodecontamination of pathogens in blood |
| 04/25/2007 | EP1648607B1 Stack of supports, in particular for cryopreservation of biological samples |
| 04/25/2007 | EP1589814A4 Use of three-dimensional microfabricated tissue engineered systems for pharmacologic applications |
| 04/25/2007 | EP1421120B1 Hyperbranched amylopectin for use in methods for surgical or therapeutic treatment of mammals or in diagnostic methods, especially for use as a plasma volume expander |
| 04/25/2007 | EP0796040B1 Method and bag set for concentrating white cells |
| 04/25/2007 | CN1951185A Goat sperm liquid-state preservation method |
| 04/24/2007 | US7208265 Method of cryopreserving selected sperm cells |
| 04/19/2007 | WO2007044047A1 Apparatus and method for microbial and forensic sampling and manipulation |
| 04/19/2007 | WO2007043984A2 Method for determining composition balance of cooled brine |
| 04/19/2007 | WO2007043698A1 Solution for preserving liver |
| 04/19/2007 | WO2007041992A2 Composition for destroying thread algae |
| 04/19/2007 | WO2006113914A3 Methods, compositions and articles of manufacture for enhancing survivability of cells, tissues, organs, and organisms |
| 04/19/2007 | WO2005020893A3 Therapeutic platelets and methods |
| 04/19/2007 | US20070087324 Method of providing readily available cellular material derived from peripheral blood |
| 04/19/2007 | US20070087323 Sampling system |
| 04/19/2007 | US20070087322 Method of preserving early embryos of experimental animals by vitrification |
| 04/19/2007 | US20070087321 Post-thaw survival of chryopreserved biological material by hydrostatic pressure challenge |
| 04/19/2007 | US20070087320 Medium for conservation of organs, biological tissues or living cells |
| 04/19/2007 | US20070084222 Systems and methods for freezing, storing, transporting, and thawing biopharmacuetical material |
| 04/19/2007 | DE10346793B4 Kühleinrichtung zur Kryokonservierung und entsprechendes Betriebsverfahren Cooling device for cryopreservation and corresponding operating method |
| 04/19/2007 | CA2624961A1 Composition for destroying thread algae |
| 04/18/2007 | EP1774852A2 Container for freezing teeth |
| 04/18/2007 | EP1773118A2 Lysine citrate for plasma protein and donor protection |
| 04/18/2007 | EP1773117A1 Delivery of high cell mass in a syringe and related methods of cryopreserving cells |
| 04/18/2007 | CN1311072C Preparation method of dried active amnion |
| 04/18/2007 | CN1311070C Method and device for dry conservation of biological liquid sample |
| 04/17/2007 | US7204959 Paraformaldehyde with cellulose ether stabilizer and buffer |
| 04/12/2007 | WO2007041452A2 Methods for preparation of live body tissue for examination |
| 04/12/2007 | WO2007040271A1 Decomposition progression retarder for harmful small animal, rodenticide composition, method of retarding decomposition progression, and indirect method of controlling pest insect |
| 04/12/2007 | WO2007014639A3 Method for isolating stem cells from cryopreserved dental tissue |
| 04/12/2007 | DE102005048625A1 System for non-cardioplegic preservation of donor hearts for transplantation, comprises an equipment for the preservation of donor hearts, coaxial aortic cannula, perfusion management, organ holding bag and perfusion solution |
| 04/11/2007 | CN1309301C Ultra low temperature refrigeration method for preserving sperm of sturgeon |
| 04/10/2007 | US7202341 Stabilized hemoglobin solutions |
| 04/10/2007 | US7202020 includes a preservation medium of plasma and a gel-former in a concentration such that the medium is in a sufficiently fluent state at 37 degrees C. to allow platelets to move within the medium and sufficiently gelatinous state at 5 degrees C. to prevent moving; suitable for direct transfusion |
| 04/10/2007 | US7200906 Earth contact burial container, burial systems and methods |
| 04/05/2007 | WO2007038341A2 Methods of organ protection |
| 04/05/2007 | WO2007036628A1 Sheathing for packaging a predetermined volume of a biological substance designed to be immersed in a liquid cryogenic agent |
| 04/05/2007 | WO2007036627A1 Assembly for packaging a predetermined volume of substance to be preserved by cryogenic vitrification |
| 04/05/2007 | US20070077546 Concentration techniques in chromatographic separation |
| 04/05/2007 | US20070077545 Sperm protective polypeptides and uses thereof |
| 04/05/2007 | US20070077237 Method for freezing, thawing and transplantation of viable cartilage |
| 04/05/2007 | DE102005047438A1 Tooth freezing container for cryopreservation of dental tissue samples, comprises uptake space for receiving solution for washing the sample, and receiver arranged in the uptake space to keep the sample in defined position during freezing |
| 04/05/2007 | CA2623666A1 Dry platelet composition |